Lineage for d1vs7c1 (1vs7 C:1-105)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860188Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 860215Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 860216Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 860229Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 860232Species Escherichia coli [TaxId:562] [160236] (24 PDB entries)
    Uniprot P0A7V3 1-105
  8. 860240Domain d1vs7c1: 1vs7 C:1-105 [144477]
    Other proteins in same PDB: d1vs7b1, d1vs7c2, d1vs7d1, d1vs7e1, d1vs7e2, d1vs7f1, d1vs7g1, d1vs7h1, d1vs7i1, d1vs7j1, d1vs7k1, d1vs7l1, d1vs7m1, d1vs7n1, d1vs7o1, d1vs7p1, d1vs7q1, d1vs7r1, d1vs7s1, d1vs7t1, d1vs7u1
    automatically matched to 2AVY C:1-105
    complexed with ksg, mg

Details for d1vs7c1

PDB Entry: 1vs7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d1vs7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs7c1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev

SCOP Domain Coordinates for d1vs7c1:

Click to download the PDB-style file with coordinates for d1vs7c1.
(The format of our PDB-style files is described here.)

Timeline for d1vs7c1: