SCOP 1.75: Domain d1vs5e1: 1vs5 E:78-158

Lineage for d1vs5e1 (1vs5 E:78-158)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
   Uniprot P0A7W1 78-158

8. Domain d1vs5e1: 1vs5 E:78-158 [144439]
   Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5c2, d1vs5d1, d1vs5e2, d1vs5f1, d1vs5g1, d1vs5h1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5p1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1
   automatically matched to 2AVY E:78-158
   complexed with ksg, mg

Details for d1vs5e1

PDB Entry: 1vs5, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d1vs5e1:

Sequence; same for both SEQRES and ATOM records:

>d1vs5e1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

Timeline for d1vs5e1:

• d1vs5e1 is new in SCOP 1.75
  
• d1vs5e1 appears in SCOPe 2.01
  
• d1vs5e1 appears in the current release, SCOPe 2.08