SCOP 1.75: Domain d1vs5c2: 1vs5 C:106-206

Lineage for d1vs5c2 (1vs5 C:106-206)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
   Uniprot P0A7V3 106-206

8. Domain d1vs5c2: 1vs5 C:106-206 [144437]
   Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5d1, d1vs5e1, d1vs5e2, d1vs5f1, d1vs5g1, d1vs5h1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5p1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1
   automatically matched to 2AVY C:106-206
   complexed with ksg, mg

Details for d1vs5c2

PDB Entry: 1vs5, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d1vs5c2:

Sequence; same for both SEQRES and ATOM records:

>d1vs5c2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

Timeline for d1vs5c2:

• d1vs5c2 is new in SCOP 1.75
  
• d1vs5c2 appears in SCOPe 2.01
  
• d1vs5c2 appears in the current release, SCOPe 2.08