Lineage for d1vq5g1 (1vq5 G:12-73)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 900578Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 900579Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 900580Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 900581Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 900582Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 900597Domain d1vq5g1: 1vq5 G:12-73 [144412]
    Other proteins in same PDB: d1vq511, d1vq521, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1
    automatically matched to 1VQ4 G:12-73
    complexed with 1ma, 2op, 5aa, cd, cl, dcz, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq5g1

PDB Entry: 1vq5 (more details), 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOP Domain Sequences for d1vq5g1:

Sequence, based on SEQRES records: (download)

>d1vq5g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1vq5g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1vq5g1:

Click to download the PDB-style file with coordinates for d1vq5g1.
(The format of our PDB-style files is described here.)

Timeline for d1vq5g1: