Lineage for d1vq5j1 (1vq5 J:4-145)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825308Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 825309Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 825310Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 825311Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 825312Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries)
    Uniprot P29198
  8. 825327Domain d1vq5j1: 1vq5 J:4-145 [120110]
    Other proteins in same PDB: d1vq511, d1vq521, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5g1, d1vq5h1, d1vq5i1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1
    automatically matched to d1ffkg_
    complexed with 1ma, 2op, 5aa, cd, cl, dcz, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq5j1

PDB Entry: 1vq5 (more details), 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (J:) 50S ribosomal protein L13P

SCOP Domain Sequences for d1vq5j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq5j1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1vq5j1:

Click to download the PDB-style file with coordinates for d1vq5j1.
(The format of our PDB-style files is described here.)

Timeline for d1vq5j1: