Lineage for d1pvmb4 (1pvm B:1-142)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167405Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2167406Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2167407Family d.37.1.1: CBS-domain pair [54632] (21 protein domains)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2167440Protein Hypothetical protein Ta0289 [102899] (1 species)
    contains extra C-terminal zinc-finger domain
  7. 2167441Species Thermoplasma acidophilum [TaxId:2303] [102900] (2 PDB entries)
  8. 2167443Domain d1pvmb4: 1pvm B:1-142 [144368]
    Other proteins in same PDB: d1pvma3, d1pvmb3, d1pvmb5
    structural genomics
    complexed with hg

Details for d1pvmb4

PDB Entry: 1pvm (more details), 1.5 Å

PDB Description: crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum
PDB Compounds: (B:) conserved hypothetical protein Ta0289

SCOPe Domain Sequences for d1pvmb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvmb4 d.37.1.1 (B:1-142) Hypothetical protein Ta0289 {Thermoplasma acidophilum [TaxId: 2303]}
mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfi
prnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvgivtltd
lsrylsrasitdillshrtkdy

SCOPe Domain Coordinates for d1pvmb4:

Click to download the PDB-style file with coordinates for d1pvmb4.
(The format of our PDB-style files is described here.)

Timeline for d1pvmb4: