![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
![]() | Protein Hypothetical protein Ta0289 [102899] (1 species) contains extra C-terminal zinc-finger domain |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [102900] (2 PDB entries) |
![]() | Domain d1pvmb4: 1pvm B:1-142 [144368] Other proteins in same PDB: d1pvma3, d1pvmb3, d1pvmb5 structural genomics complexed with hg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1pvm (more details), 1.5 Å
SCOPe Domain Sequences for d1pvmb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvmb4 d.37.1.1 (B:1-142) Hypothetical protein Ta0289 {Thermoplasma acidophilum [TaxId: 2303]} mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfi prnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvgivtltd lsrylsrasitdillshrtkdy
Timeline for d1pvmb4: