Lineage for d1oi4a1 (1oi4 A:23-192)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2117924Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2118026Protein Hypothetical protein YhbO [89601] (1 species)
  7. 2118027Species Escherichia coli [TaxId:562] [89602] (1 PDB entry)
  8. 2118028Domain d1oi4a1: 1oi4 A:23-192 [144364]
    Other proteins in same PDB: d1oi4a2, d1oi4b2
    structural genomics

Details for d1oi4a1

PDB Entry: 1oi4 (more details), 2.03 Å

PDB Description: crystal structure of yhbo from escherichia coli
PDB Compounds: (A:) hypothetical protein yhbo

SCOPe Domain Sequences for d1oi4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]}
skkiavlitdefedseftspadefrkaghevitiekqagktvkgkkgeasvtidksidev
tpaefdalllpgghspdylrgdnrfvtftrdfvnsgkpvfaichgpqllisadvirgrkl
tavkpiiidvknagaefydqevvvdkdqlvtsrtpddlpafnrealrllg

SCOPe Domain Coordinates for d1oi4a1:

Click to download the PDB-style file with coordinates for d1oi4a1.
(The format of our PDB-style files is described here.)

Timeline for d1oi4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oi4a2