SCOP 1.75: Domain d2uxce1: 2uxc E:74-154

Lineage for d2uxce1 (2uxc E:74-154)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
   Uniprot P27152
   Uniprot P80373
   Uniprot P27152 ! Uniprot P80373

8. Domain d2uxce1: 2uxc E:74-154 [140007]
   Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1
   automatically matched to d1i94e1
   complexed with k, mg, par, zn

Details for d2uxce1

PDB Entry: 2uxc, 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.

PDB Compounds: (E:) ribosomal protein s5

SCOP Domain Sequences for d2uxce1:

Sequence; same for both SEQRES and ATOM records:

>d2uxce1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d2uxce1:

• d2uxce1 first appeared in SCOP 1.73
  
• d2uxce1 appears in SCOPe 2.01
  
• d2uxce1 appears in the current release, SCOPe 2.08