| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) ![]() |
| Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit |
| Protein Ribosomal protein S15 [47065] (3 species) |
| Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) Uniprot P80378 |
| Domain d2uxco1: 2uxc O:2-89 [140018] Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1 automatically matched to d1ab3__ complexed with k, mg, par, zn |
PDB Entry: 2uxc (more details), 2.9 Å
SCOP Domain Sequences for d2uxco1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxco1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg
Timeline for d2uxco1: