Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins) |
Domain d2uwmb2: 2uwm B:511-574 [139996] automatically matched to d1lvaa3 protein/RNA complex |
PDB Entry: 2uwm (more details), 2.31 Å
SCOPe Domain Sequences for d2uwmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uwmb2 a.4.5.35 (B:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} fsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindef ywhr
Timeline for d2uwmb2: