SCOP 1.75: Domain d2uubc2: 2uub C:107-207

Lineage for d2uubc2 (2uub C:107-207)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
   Uniprot P80372

8. Domain d2uubc2: 2uub C:107-207 [139934]
   Other proteins in same PDB: d2uubb1, d2uubc1, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1
   automatically matched to d1fjgc2
   complexed with 6mz, cm0, k, mg, par, zn

Details for d2uubc2

PDB Entry: 2uub, 2.8 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d2uubc2:

Sequence; same for both SEQRES and ATOM records:

>d2uubc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d2uubc2:

• d2uubc2 first appeared in SCOP 1.73
  
• d2uubc2 appears in SCOPe 2.01
  
• d2uubc2 appears in the current release, SCOPe 2.08