Class a: All alpha proteins [46456] (285 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension automatically mapped to Pfam PF00416 |
Protein Ribosomal protein S13 [46948] (2 species) |
Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries) Uniprot P80377 |
Domain d2uu9m1: 2uu9 M:2-126 [139904] Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1, d2uu9u1 automatically matched to d1fjgm_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uu9 (more details), 3.1 Å
SCOPe Domain Sequences for d2uu9m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uu9m1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d2uu9m1: