Lineage for d2q5aa2 (2q5a A:51-163)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548539Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
    Domain 1 is a WW-domain
  7. 2548540Species Human (Homo sapiens) [TaxId:9606] [54548] (51 PDB entries)
  8. 2548545Domain d2q5aa2: 2q5a A:51-163 [139883]
    Other proteins in same PDB: d2q5aa1
    complexed with 16p

Details for d2q5aa2

PDB Entry: 2q5a (more details), 1.5 Å

PDB Description: human Pin1 bound to L-PEPTIDE
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2q5aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q5aa2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

SCOPe Domain Coordinates for d2q5aa2:

Click to download the PDB-style file with coordinates for d2q5aa2.
(The format of our PDB-style files is described here.)

Timeline for d2q5aa2: