Lineage for d2q4hb2 (2q4h B:196-350)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536878Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2536879Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2537065Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
    duplication: consists of 2 HIT-like motifs
    binds zinc and iron ions
  6. 2537066Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species)
  7. 2537099Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (5 PDB entries)
    Uniprot Q9FK51
  8. 2537103Domain d2q4hb2: 2q4h B:196-350 [139856]
    automatically matched to d1vkva2
    complexed with amp, edo, zn

Details for d2q4hb2

PDB Entry: 2q4h (more details), 1.83 Å

PDB Description: Ensemble refinement of the crystal structure of GALT-like protein from Arabidopsis thaliana At5g18200
PDB Compounds: (B:) Probable galactose-1-phosphate uridyl transferase

SCOPe Domain Sequences for d2q4hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4hb2 d.13.1.2 (B:196-350) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapfaatypfeiwiipkdh
sshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplkvtesqlpythwflqi
vpqlsgvggfeigtgcyinpvfpedvakvmrevsl

SCOPe Domain Coordinates for d2q4hb2:

Click to download the PDB-style file with coordinates for d2q4hb2.
(The format of our PDB-style files is described here.)

Timeline for d2q4hb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q4hb1