Lineage for d2q4ca2 (2q4c A:2-317)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000102Protein Plant annexin-like protein [47892] (2 species)
  7. 2000106Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116946] (2 PDB entries)
    Uniprot Q9SYT0
  8. 2000107Domain d2q4ca2: 2q4c A:2-317 [139843]
    Other proteins in same PDB: d2q4ca3, d2q4cb3
    automated match to d1ycna_

Details for d2q4ca2

PDB Entry: 2q4c (more details), 2.51 Å

PDB Description: Ensemble refinement of the protein crystal structure of annexin from Arabidopsis thaliana gene At1g35720
PDB Compounds: (A:) Annexin D1

SCOPe Domain Sequences for d2q4ca2:

Sequence, based on SEQRES records: (download)

>d2q4ca2 a.65.1.1 (A:2-317) Plant annexin-like protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
atlkvsdsvpapsddaeqlrtafegwgtnedliisilahrsaeqrkvirqayhetygedl
lktldkelsndferaillwtlepgerdallaneatkrwtssnqvlmevactrtstqllha
rqayharykksleedvahhttgdfrkllvslvtsyryegdevnmtlakqeaklvhekikd
khyndedvirilstrskaqinatfnryqddhgeeilksleegddddkflallrstiqclt
rpelyfvdvlrsainktgtdegaltrivttraeidlkvigeeyqrrnsiplekaitkdtr
gdyekmlvallgedda

Sequence, based on observed residues (ATOM records): (download)

>d2q4ca2 a.65.1.1 (A:2-317) Plant annexin-like protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
atlkvsdsvpapsddaeqlrtafeedliisilahrsaeqrkvirqayhetygedllktld
kelsndferaillwtlepgerdallaneatkrwtssnqvlmevactrtstqllharqayh
arykksleedvahhttgdfrkllvslvtsyryegdevnmtlakqeaklvhekikdkhynd
edvirilstrskaqinatfnryqddhgeeilksleegddddkflallrstiqcltrpely
fvdvlrsainktgtdegaltrivttraeidlkvigeeyqrrnsiplekaitkdtrgdyek
mlvallgedda

SCOPe Domain Coordinates for d2q4ca2:

Click to download the PDB-style file with coordinates for d2q4ca2.
(The format of our PDB-style files is described here.)

Timeline for d2q4ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q4ca3