SCOP 1.73: Domain d2q47a1: 2q47 A:52-202

Lineage for d2q47a1 (2q47 A:52-202)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins)

6. Protein Putative phosphatase At1g05000 [117579] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117580] (2 PDB entries)

8. Domain d2q47a1: 2q47 A:52-202 [139827]
   automatically matched to d1xria_
   complexed with so4

Details for d2q47a1

PDB Entry: 2q47, 3.3 Å

PDB Description: Ensemble refinement of the protein crystal structure of a putative phosphoprotein phosphatase from Arabidopsis thaliana gene At1g05000

PDB Compounds: (A:) Probable tyrosine-protein phosphatase At1g05000

SCOP Domain Sequences for d2q47a1:

Sequence; same for both SEQRES and ATOM records:

>d2q47a1 c.45.1.1 (A:52-202) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl
fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc
ltsifdeyqrfaaakarvsdqrfmeifdvss

Timeline for d2q47a1:

• d2q47a1 is new in SCOP 1.73
  
• d2q47a1 appears in SCOP 1.75
  
• d2q47a1 appears in the current release, SCOPe 2.08