Lineage for d1xria_ (1xri A:)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) 
share with the family I the common active site structure with a circularly permuted topology
Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins) 
Protein Putative phosphatase At1g05000 [117579] (1 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117580] (2 PDB entries) 
Domain d1xria_: 1xri A: [115879]
Details for d1xria_
PDB Entry: 1xri (more details), 3.3 Å
PDB Description: x-ray structure of a putative phosphoprotein phosphatase from arabidopsis thaliana gene at1g05000
PDB Compounds: (A:) At1g05000SCOP Domain Sequences for d1xria_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl
fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc
ltsifdeyqrfaaakarvsdqrfmeifdvss
SCOP Domain Coordinates for d1xria_:
Click to download the PDB-style file with coordinates for d1xria_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xria_:
- d1xria_ first appeared in SCOP 1.71
- d1xria_ appears in SCOP 1.75
- d1xria_ appears in the current release, SCOPe 2.08
View in 3D
