SCOPe 2.01: Domain d2q1na1: 2q1n A:7-146

Lineage for d2q1na1 (2q1n A:7-146)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53074] (26 PDB entries)

8. Domain d2q1na1: 2q1n A:7-146 [139783]
   automatically matched to d1hlua1
   complexed with anp, ca, lar

Details for d2q1na1

PDB Entry: 2q1n, 2.7 Å

PDB Description: actin dimer cross-linked between residues 41 and 374

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2q1na1:

Sequence, based on SEQRES records:

>d2q1na1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
alvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgilt
lkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfet
fnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d2q1na1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
alvcdngsglvkagfagddapravfpsivgrprhltlkypiehgiitnwddmekiwhhtf
ynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvaiqavlslyasg

Timeline for d2q1na1:

• d2q1na1 first appeared in SCOP 1.73
  
• d2q1na1 appears in SCOP 1.75
  
• d2q1na1 appears in SCOPe 2.02
  
• d2q1na1 appears in the current release, SCOPe 2.08