Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) |
Family b.82.3.2: cAMP-binding domain [51210] (12 proteins) Pfam PF00027 |
Protein HCN pacemaker channel [101993] (1 species) potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel |
Species Mouse (Mus musculus) [TaxId:10090] [101994] (4 PDB entries) |
Domain d2q0ab1: 2q0a B:443-635 [139782] automatically matched to d1q5oa_ complexed with pcg; mutant |
PDB Entry: 2q0a (more details), 2.25 Å
SCOP Domain Sequences for d2q0ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q0ab1 b.82.3.2 (B:443-635) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr rafetvaidrldr
Timeline for d2q0ab1: