Lineage for d2q0ab1 (2q0a B:443-635)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 810399Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 810405Family b.82.3.2: cAMP-binding domain [51210] (12 proteins)
    Pfam PF00027
  6. 810461Protein HCN pacemaker channel [101993] (1 species)
    potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel
  7. 810462Species Mouse (Mus musculus) [TaxId:10090] [101994] (4 PDB entries)
  8. 810469Domain d2q0ab1: 2q0a B:443-635 [139782]
    automatically matched to d1q5oa_
    complexed with pcg; mutant

Details for d2q0ab1

PDB Entry: 2q0a (more details), 2.25 Å

PDB Description: structure and rearrangements in the carboxy-terminal region of spih channels
PDB Compounds: (B:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOP Domain Sequences for d2q0ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q0ab1 b.82.3.2 (B:443-635) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldr

SCOP Domain Coordinates for d2q0ab1:

Click to download the PDB-style file with coordinates for d2q0ab1.
(The format of our PDB-style files is described here.)

Timeline for d2q0ab1: