SCOP 1.73: Domain d2q0ab1: 2q0a B:443-635

Lineage for d2q0ab1 (2q0a B:443-635)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (10 proteins)
   Pfam PF00027

6. Protein HCN pacemaker channel [101993] (1 species)
   potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel

7. Species Mouse (Mus musculus) [TaxId:10090] [101994] (4 PDB entries)

8. Domain d2q0ab1: 2q0a B:443-635 [139782]
   automatically matched to d1q5oa_
   complexed with pcg; mutant

Details for d2q0ab1

PDB Entry: 2q0a, 2.25 Å

PDB Description: structure and rearrangements in the carboxy-terminal region of spih channels

PDB Compounds: (B:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOP Domain Sequences for d2q0ab1:

Sequence; same for both SEQRES and ATOM records:

>d2q0ab1 b.82.3.2 (B:443-635) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldr

Timeline for d2q0ab1:

• d2q0ab1 is new in SCOP 1.73
  
• d2q0ab1 appears in SCOP 1.75
  
• d2q0ab1 appears in the current release, SCOPe 2.08, called d2q0ab_