Lineage for d2pvva2 (2pvv A:118-350)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979734Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 979857Superfamily c.8.4: PA domain [52025] (1 family) (S)
  5. 979858Family c.8.4.1: PA domain [52026] (2 proteins)
  6. 979859Protein Glutamate carboxypeptidase II [141984] (1 species)
  7. 979860Species Human (Homo sapiens) [TaxId:9606] [141985] (14 PDB entries)
    Uniprot Q04609 118-350
  8. 979868Domain d2pvva2: 2pvv A:118-350 [139753]
    Other proteins in same PDB: d2pvva1, d2pvva3
    automatically matched to 2C6C A:118-350
    complexed with ca, cl, nag, ose, zn

Details for d2pvva2

PDB Entry: 2pvv (more details), 2.11 Å

PDB Description: structure of human glutamate carboxypeptidase ii (gcpii) in complex with l-serine-o-sulfate
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d2pvva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvva2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn

SCOPe Domain Coordinates for d2pvva2:

Click to download the PDB-style file with coordinates for d2pvva2.
(The format of our PDB-style files is described here.)

Timeline for d2pvva2: