Lineage for d2pg1d_ (2pg1 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944700Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 2944701Superfamily d.39.1: DLC [54648] (1 family) (S)
    automatically mapped to Pfam PF01221
  5. 2944702Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 2944703Protein Dynein light chain 1 (DLC1) [54650] (3 species)
    synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase
  7. 2944704Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (14 PDB entries)
  8. 2944729Domain d2pg1d_: 2pg1 D: [139687]
    automated match to d1rhwa_
    complexed with so4

Details for d2pg1d_

PDB Entry: 2pg1 (more details), 2.8 Å

PDB Description: Structural analysis of a cytoplasmic dynein Light Chain-Intermediate Chain complex
PDB Compounds: (D:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d2pg1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pg1d_ d.39.1.1 (D:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
yvthetrhfiyfylgqvaillfksg

SCOPe Domain Coordinates for d2pg1d_:

Click to download the PDB-style file with coordinates for d2pg1d_.
(The format of our PDB-style files is described here.)

Timeline for d2pg1d_: