PDB entry 2pg1

View 2pg1 on RCSB PDB site
Description: Structural analysis of a cytoplasmic dynein Light Chain-Intermediate Chain complex
Class: structural protein
Keywords: Dynein intermediate chain, dynein light chain, LC8, PIN, TcTex1, STRUCTURAL PROTEIN
Deposited on 2007-04-06, released 2007-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.208
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: ctp, Cdlc1, ddlc1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pg1a_
  • Chain 'B':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: ctp, Cdlc1, ddlc1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pg1b_
  • Chain 'C':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: ctp, Cdlc1, ddlc1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pg1c_
  • Chain 'D':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: ctp, Cdlc1, ddlc1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pg1d_
  • Chain 'E':
    Compound: Dynein light chain Tctex-type
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dlc90F, Tctex
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94524 (Start-110)
      • modified residue (65)
      • modified residue (67)
      • modified residue (99)
  • Chain 'F':
    Compound: Dynein light chain Tctex-type
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dlc90F, Tctex
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94524 (Start-110)
      • modified residue (65)
      • modified residue (67)
      • modified residue (99)
  • Chain 'G':
    Compound: Dynein light chain Tctex-type
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dlc90F, Tctex
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94524 (Start-110)
      • modified residue (65)
      • modified residue (67)
      • modified residue (99)
  • Chain 'H':
    Compound: Dynein light chain Tctex-type
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dlc90F, Tctex
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94524 (Start-110)
      • modified residue (65)
      • modified residue (67)
      • modified residue (99)
  • Chain 'I':
    Compound: Cytoplasmic dynein 1 intermediate chain 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dync1i2, Dnci2, Dncic2
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Cytoplasmic dynein 1 intermediate chain 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dync1i2, Dnci2, Dncic2
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Cytoplasmic dynein 1 intermediate chain 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dync1i2, Dnci2, Dncic2
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Cytoplasmic dynein 1 intermediate chain 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dync1i2, Dnci2, Dncic2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pg1A (A:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pg1A (A:)
    kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pg1B (B:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pg1B (B:)
    kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pg1C (C:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pg1C (C:)
    kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pg1D (D:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pg1D (D:)
    kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.