Lineage for d2pg1a1 (2pg1 A:5-89)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721724Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 721725Superfamily d.39.1: DLC [54648] (1 family) (S)
  5. 721726Family d.39.1.1: DLC [54649] (2 proteins)
    8 kDa dynein light chain, DLC8
  6. 721727Protein Dynein light chain 1 (DLC1) [54650] (3 species)
    synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase
  7. 721728Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (2 PDB entries)
  8. 721729Domain d2pg1a1: 2pg1 A:5-89 [139684]
    automatically matched to d1rhwa_
    complexed with so4

Details for d2pg1a1

PDB Entry: 2pg1 (more details), 2.8 Å

PDB Description: Structural analysis of a cytoplasmic dynein Light Chain-Intermediate Chain complex
PDB Compounds: (A:) Dynein light chain 1, cytoplasmic

SCOP Domain Sequences for d2pg1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pg1a1 d.39.1.1 (A:5-89) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
yvthetrhfiyfylgqvaillfksg

SCOP Domain Coordinates for d2pg1a1:

Click to download the PDB-style file with coordinates for d2pg1a1.
(The format of our PDB-style files is described here.)

Timeline for d2pg1a1: