SCOP 1.73: Domain d2pg1c1: 2pg1 C:5-89

Lineage for d2pg1c1 (2pg1 C:5-89)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)

5. Family d.39.1.1: DLC [54649] (2 proteins)
   8 kDa dynein light chain, DLC8

6. Protein Dynein light chain 1 (DLC1) [54650] (3 species)
   synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (2 PDB entries)

8. Domain d2pg1c1: 2pg1 C:5-89 [139686]
   automatically matched to d1rhwa_
   complexed with so4

Details for d2pg1c1

PDB Entry: 2pg1, 2.8 Å

PDB Description: Structural analysis of a cytoplasmic dynein Light Chain-Intermediate Chain complex

PDB Compounds: (C:) Dynein light chain 1, cytoplasmic

SCOP Domain Sequences for d2pg1c1:

Sequence; same for both SEQRES and ATOM records:

>d2pg1c1 d.39.1.1 (C:5-89) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
yvthetrhfiyfylgqvaillfksg

Timeline for d2pg1c1:

• d2pg1c1 is new in SCOP 1.73
  
• d2pg1c1 appears in SCOP 1.75
  
• d2pg1c1 appears in the current release, SCOPe 2.08, called d2pg1c_