Lineage for d2pfna2 (2pfn A:329-385)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643336Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 643337Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 643464Protein DNA polymerase lambda [101253] (1 species)
  7. 643465Species Human (Homo sapiens) [TaxId:9606] [101254] (14 PDB entries)
  8. 643468Domain d2pfna2: 2pfn A:329-385 [139673]
    Other proteins in same PDB: d2pfna1, d2pfna3
    automatically matched to d1rzta2
    complexed with dup, mg, na; mutant

Details for d2pfna2

PDB Entry: 2pfn (more details), 1.9 Å

PDB Description: na in the active site of dna polymerase lambda
PDB Compounds: (A:) DNA polymerase lambda

SCOP Domain Sequences for d2pfna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pfna2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOP Domain Coordinates for d2pfna2:

Click to download the PDB-style file with coordinates for d2pfna2.
(The format of our PDB-style files is described here.)

Timeline for d2pfna2: