![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.6: IlvH-like [143376] (2 proteins) Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes |
![]() | Protein Acetolactate synthase small subunit, IlvH [143377] (3 species) |
![]() | Species Nitrosomonas europaea [TaxId:915] [143380] (1 PDB entry) Uniprot Q82UZ2 1-77! Uniprot Q82UZ2 78-163 |
![]() | Domain d2pc6c1: 2pc6 C:78-163 [139651] Other proteins in same PDB: d2pc6a3, d2pc6c3 automated match to d2f1fa2 complexed with ca, unl |
PDB Entry: 2pc6 (more details), 2.5 Å
SCOPe Domain Sequences for d2pc6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pc6c1 d.58.18.6 (C:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} segyverelmlvkvravgkdreemkrladifrgniidvtnelytieltgtrskldgflqa vdcnlileiartgvsglsrgervlkl
Timeline for d2pc6c1: