Lineage for d2pc6c1 (2pc6 C:78-163)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197025Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2197123Family d.58.18.6: IlvH-like [143376] (2 proteins)
    Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes
  6. 2197124Protein Acetolactate synthase small subunit, IlvH [143377] (3 species)
  7. 2197130Species Nitrosomonas europaea [TaxId:915] [143380] (1 PDB entry)
    Uniprot Q82UZ2 1-77! Uniprot Q82UZ2 78-163
  8. 2197135Domain d2pc6c1: 2pc6 C:78-163 [139651]
    Other proteins in same PDB: d2pc6a3, d2pc6c3
    automated match to d2f1fa2
    complexed with ca, unl

Details for d2pc6c1

PDB Entry: 2pc6 (more details), 2.5 Å

PDB Description: crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea
PDB Compounds: (C:) Probable acetolactate synthase isozyme III (Small subunit)

SCOPe Domain Sequences for d2pc6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pc6c1 d.58.18.6 (C:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]}
segyverelmlvkvravgkdreemkrladifrgniidvtnelytieltgtrskldgflqa
vdcnlileiartgvsglsrgervlkl

SCOPe Domain Coordinates for d2pc6c1:

Click to download the PDB-style file with coordinates for d2pc6c1.
(The format of our PDB-style files is described here.)

Timeline for d2pc6c1: