Lineage for d2pa3a1 (2pa3 A:108-295)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1152932Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 1153003Protein Phosphoglycerate dehydrogenase [51839] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 1153004Species Escherichia coli [TaxId:562] [51840] (7 PDB entries)
  8. 1153023Domain d2pa3a1: 2pa3 A:108-295 [139638]
    Other proteins in same PDB: d2pa3a2, d2pa3a3
    automatically matched to d1psda1
    complexed with nai, ser; mutant

Details for d2pa3a1

PDB Entry: 2pa3 (more details), 2.74 Å

PDB Description: crystal structure of serine bound g336v mutant of e.coli phosphoglycerate dehydrogenase
PDB Compounds: (A:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d2pa3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pa3a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ntrsvaelvigelllllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlg
ilaeslgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeis
lmkpgsllinasrgtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnv
lltphigg

SCOPe Domain Coordinates for d2pa3a1:

Click to download the PDB-style file with coordinates for d2pa3a1.
(The format of our PDB-style files is described here.)

Timeline for d2pa3a1: