Lineage for d2p9se1 (2p9s E:2-174)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779037Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 779038Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
  5. 779039Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (1 protein)
  6. 779040Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species)
  7. 779041Species Cow (Bos taurus) [TaxId:9913] [69063] (10 PDB entries)
    Uniprot O15145 # 100% sequence identity
  8. 779048Domain d2p9se1: 2p9s E:2-174 [139627]
    Other proteins in same PDB: d2p9sa1, d2p9sa2, d2p9sc1, d2p9sd1, d2p9sd2, d2p9sf1, d2p9sg1
    automatically matched to d1k8ke_
    complexed with atp, mg

Details for d2p9se1

PDB Entry: 2p9s (more details), 2.68 Å

PDB Description: Structure of bovine Arp2/3 complex co-crystallized with ATP/Mg2+
PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOP Domain Sequences for d2p9se1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9se1 a.148.1.1 (E:2-174) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls

SCOP Domain Coordinates for d2p9se1:

Click to download the PDB-style file with coordinates for d2p9se1.
(The format of our PDB-style files is described here.)

Timeline for d2p9se1: