Class a: All alpha proteins [46456] (290 folds) |
Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) automatically mapped to Pfam PF04062 |
Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins) |
Protein automated matches [190347] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187174] (12 PDB entries) |
Domain d2p9se_: 2p9s E: [139627] Other proteins in same PDB: d2p9sa1, d2p9sa2, d2p9sb_, d2p9sc_, d2p9sd1, d2p9sd2, d2p9sf_, d2p9sg_ automated match to d1k8ke_ complexed with atp, mg |
PDB Entry: 2p9s (more details), 2.68 Å
SCOPe Domain Sequences for d2p9se_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9se_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls
Timeline for d2p9se_: