Lineage for d2p9pd1 (2p9p D:1-120)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050398Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1050472Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1050473Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 1050474Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 1050475Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries)
    Uniprot O15144 1-282 # 100% sequence identity
  8. 1050494Domain d2p9pd1: 2p9p D:1-120 [139617]
    Other proteins in same PDB: d2p9pa1, d2p9pa2, d2p9pc_, d2p9pe_, d2p9pf_, d2p9pg_
    automatically matched to d1k8kd1
    complexed with adp, ca

Details for d2p9pd1

PDB Entry: 2p9p (more details), 2.9 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp
PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOPe Domain Sequences for d2p9pd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9pd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

SCOPe Domain Coordinates for d2p9pd1:

Click to download the PDB-style file with coordinates for d2p9pd1.
(The format of our PDB-style files is described here.)

Timeline for d2p9pd1: