Class a: All alpha proteins [46456] (289 folds) |
Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) automatically mapped to Pfam PF04062 |
Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins) |
Protein automated matches [190347] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187174] (12 PDB entries) |
Domain d2p9ne_: 2p9n E: [139611] Other proteins in same PDB: d2p9na1, d2p9na2, d2p9nb_, d2p9nc_, d2p9nd1, d2p9nd2, d2p9nf_, d2p9ng_ automated match to d1k8ke_ complexed with adp, ca |
PDB Entry: 2p9n (more details), 2.85 Å
SCOPe Domain Sequences for d2p9ne_:
Sequence, based on SEQRES records: (download)
>d2p9ne_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
>d2p9ne_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpaprekdtdivdeaiyyfkanvffknyeikn eadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpan kqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
Timeline for d2p9ne_: