|  | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) | 
|  | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta | 
|  | Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)  | 
|  | Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins) | 
|  | Protein ARPC4 (20 kDa subunit) [69647] (1 species) | 
|  | Species Cow (Bos taurus) [TaxId:9913] [69648] (17 PDB entries) Uniprot P59998 # 100% sequence identity | 
|  | Domain d2p9if_: 2p9i F: [139588] Other proteins in same PDB: d2p9ia1, d2p9ia2, d2p9ic_, d2p9id1, d2p9id2, d2p9ie_, d2p9ig_ automated match to d1k8kf_ complexed with adp, ca | 
PDB Entry: 2p9i (more details), 2.46 Å
SCOPe Domain Sequences for d2p9if_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9if_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
Timeline for d2p9if_: