Lineage for d2p9gb2 (2p9g B:7-107,B:296-326)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 983397Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 983398Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 983422Protein Phosphoglycerate dehydrogenase [52293] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 983423Species Escherichia coli [TaxId:562] [52294] (7 PDB entries)
  8. 983441Domain d2p9gb2: 2p9g B:7-107,B:296-326 [139578]
    Other proteins in same PDB: d2p9ga1, d2p9ga3, d2p9gb1, d2p9gb3
    automatically matched to d1psda2
    complexed with nai, ser; mutant

Details for d2p9gb2

PDB Entry: 2p9g (more details), 2.8 Å

PDB Description: crystal structure of serine bound g336v,g337v double mutant of e.coli phosphoglycerate dehydrogenase
PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d2p9gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9gb2 c.23.12.1 (B:7-107,B:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagkli
kysdngstlsavn

SCOPe Domain Coordinates for d2p9gb2:

Click to download the PDB-style file with coordinates for d2p9gb2.
(The format of our PDB-style files is described here.)

Timeline for d2p9gb2: