Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein) |
Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species) |
Species Escherichia coli [TaxId:562] [55024] (7 PDB entries) |
Domain d2p9ec3: 2p9e C:327-410 [139570] Other proteins in same PDB: d2p9ea1, d2p9ea2, d2p9eb1, d2p9eb2, d2p9ec1, d2p9ec2, d2p9ed1, d2p9ed2 automatically matched to d1psda3 complexed with cit, nai, po4, so4; mutant |
PDB Entry: 2p9e (more details), 2.6 Å
SCOPe Domain Sequences for d2p9ec3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9ec3 d.58.18.1 (C:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} fpevslplhvgrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead edvaekalqamkaipgtirarlly
Timeline for d2p9ec3: