PDB entry 2p9e

View 2p9e on RCSB PDB site
Description: Crystal Structure of G336V mutant of E.coli phosphoglycerate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, G336V mutant, phosphoglycerate dehydrogenase, serine biosynthesis
Deposited on 2007-03-25, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-3-phosphoglycerate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: serA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9T0 (Start-409)
      • engineered (80)
      • engineered (82)
      • engineered (249)
      • engineered (281)
      • engineered (335)
    Domains in SCOPe 2.07: d2p9ea1, d2p9ea2, d2p9ea3
  • Chain 'B':
    Compound: D-3-phosphoglycerate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: serA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9T0 (Start-409)
      • engineered (80)
      • engineered (82)
      • engineered (249)
      • engineered (281)
      • engineered (335)
    Domains in SCOPe 2.07: d2p9eb1, d2p9eb2, d2p9eb3
  • Chain 'C':
    Compound: D-3-phosphoglycerate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: serA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9T0 (Start-409)
      • engineered (80)
      • engineered (82)
      • engineered (249)
      • engineered (281)
      • engineered (335)
    Domains in SCOPe 2.07: d2p9ec1, d2p9ec2, d2p9ec3
  • Chain 'D':
    Compound: D-3-phosphoglycerate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: serA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9T0 (Start-409)
      • engineered (80)
      • engineered (82)
      • engineered (249)
      • engineered (281)
      • engineered (335)
    Domains in SCOPe 2.07: d2p9ed1, d2p9ed2, d2p9ed3
  • Heterogens: PO4, SO4, NAI, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p9eA (A:)
    makvslekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglr
    srthltedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigel
    llllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfy
    dienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasr
    gtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqea
    qeniglevagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifae
    qgvniaaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9eA (A:)
    slekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrth
    ltedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllll
    rgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydien
    klplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvv
    dipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqeaqeni
    glevagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifaeqgvn
    iaaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p9eB (B:)
    makvslekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglr
    srthltedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigel
    llllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfy
    dienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasr
    gtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqea
    qeniglevagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifae
    qgvniaaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9eB (B:)
    ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
    edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrg
    vpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydienkl
    plgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdi
    paladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqeaqenigl
    evagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifaeqgvnia
    aqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p9eC (C:)
    makvslekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglr
    srthltedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigel
    llllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfy
    dienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasr
    gtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqea
    qeniglevagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifae
    qgvniaaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9eC (C:)
    slekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrth
    ltedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllll
    rgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydien
    klplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvv
    dipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqeaqeni
    glevagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifaeqgvn
    iaaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p9eD (D:)
    makvslekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglr
    srthltedvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigel
    llllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfy
    dienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasr
    gtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqea
    qeniglevagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifae
    qgvniaaqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9eD (D:)
    kdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlte
    dvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrgv
    peanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydienklp
    lgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdip
    aladalaskhlagaaidvfptepatnsdpftsplaefdnvlltphiggstqeaqenigle
    vagklikysdngstlsavnfpevslplhvgrrlmhihenrpgvltalnkifaeqgvniaa
    qylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly