Lineage for d2p9eb1 (2p9e B:108-295)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 821313Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 821384Protein Phosphoglycerate dehydrogenase [51839] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 821385Species Escherichia coli [TaxId:562] [51840] (7 PDB entries)
  8. 821399Domain d2p9eb1: 2p9e B:108-295 [139565]
    Other proteins in same PDB: d2p9ea2, d2p9ea3, d2p9eb2, d2p9eb3, d2p9ec2, d2p9ec3, d2p9ed2, d2p9ed3
    automatically matched to d1psda1
    complexed with cit, nai, po4, so4; mutant

Details for d2p9eb1

PDB Entry: 2p9e (more details), 2.6 Å

PDB Description: crystal structure of g336v mutant of e.coli phosphoglycerate dehydrogenase
PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOP Domain Sequences for d2p9eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9eb1 c.2.1.4 (B:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ntrsvaelvigelllllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlg
ilaeslgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeis
lmkpgsllinasrgtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnv
lltphigg

SCOP Domain Coordinates for d2p9eb1:

Click to download the PDB-style file with coordinates for d2p9eb1.
(The format of our PDB-style files is described here.)

Timeline for d2p9eb1: