Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) |
Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
Protein Elongation factor 2 (eEF-2), C-terminal domain [419043] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419528] (13 PDB entries) Uniprot P32324 |
Domain d2p8yt5: 2p8y T:730-842 [139550] Other proteins in same PDB: d2p8yt1, d2p8yt2, d2p8yt3, d2p8yt4 automatically matched to d1n0ua5 complexed with apr, gdp, so1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2p8y (more details), 11.7 Å
SCOPe Domain Sequences for d2p8yt5:
Sequence, based on SEQRES records: (download)
>d2p8yt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatg gqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
>d2p8yt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lveiqcpeqavggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqa fpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d2p8yt5:
View in 3D Domains from same chain: (mouse over for more information) d2p8yt1, d2p8yt2, d2p8yt3, d2p8yt4 |