Lineage for d2p8yt5 (2p8y T:730-842)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724976Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 724977Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 724978Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 724979Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries)
  8. 725025Domain d2p8yt5: 2p8y T:730-842 [139550]
    Other proteins in same PDB: d2p8yt1, d2p8yt2, d2p8yt3
    automatically matched to d1n0ua5
    complexed with apr, dde, gdp, so1

Details for d2p8yt5

PDB Entry: 2p8y (more details)

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdp:sordarin cryo- em reconstruction
PDB Compounds: (T:) Elongation factor 2

SCOP Domain Sequences for d2p8yt5:

Sequence, based on SEQRES records: (download)

>d2p8yt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatg
gqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Sequence, based on observed residues (ATOM records): (download)

>d2p8yt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lveiqcpeqavggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqa
fpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOP Domain Coordinates for d2p8yt5:

Click to download the PDB-style file with coordinates for d2p8yt5.
(The format of our PDB-style files is described here.)

Timeline for d2p8yt5: