Lineage for d2p8wt4 (2p8w T:482-560)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206180Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 1206181Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 1206182Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 1206183Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries)
    Uniprot P32324
  8. 1206228Domain d2p8wt4: 2p8w T:482-560 [139539]
    Other proteins in same PDB: d2p8wt1, d2p8wt2, d2p8wt3
    automatically matched to d1n0ua4
    complexed with gnp

Details for d2p8wt4

PDB Entry: 2p8w (more details), 11.3 Å

PDB Description: fitted structure of eef2 in the 80s:eef2:gdpnp cryo-em reconstruction
PDB Compounds: (T:) Elongation factor 2

SCOPe Domain Sequences for d2p8wt4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8wt4 d.58.11.1 (T:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic
lqdlehdhagvplkisppv

SCOPe Domain Coordinates for d2p8wt4:

Click to download the PDB-style file with coordinates for d2p8wt4.
(The format of our PDB-style files is described here.)

Timeline for d2p8wt4: