SCOPe 2.04: Domain d2os9a1: 2os9 A:235-355

Lineage for d2os9a1 (2os9 A:235-355)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)

8. Domain d2os9a1: 2os9 A:235-355 [139290]
   Other proteins in same PDB: d2os9a2, d2os9b2, d2os9c2
   complexed with ca, ins

Details for d2os9a1

PDB Entry: 2os9, 1.7 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein D in complex with myoinositol

PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2os9a1:

Sequence; same for both SEQRES and ATOM records:

>d2os9a1 d.169.1.0 (A:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d2os9a1:

• d2os9a1 first appeared in SCOP 1.73
  
• d2os9a1 appears in SCOPe 2.03
  
• d2os9a1 appears in SCOPe 2.05
  
• d2os9a1 appears in the current release, SCOPe 2.08