Lineage for d2orvb2 (2orv B:151-191)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262730Family g.39.1.14: Type II thymidine kinase zinc finger [118276] (1 protein)
    C-terminal part of Pfam PF00265
  6. 2262731Protein Thymidine kinase, TK1, C-terminal domain [118277] (4 species)
  7. 2262735Species Human (Homo sapiens) [TaxId:9606] [118278] (2 PDB entries)
    Uniprot P04183 18-191
  8. 2262745Domain d2orvb2: 2orv B:151-191 [139277]
    Other proteins in same PDB: d2orva1, d2orvb1
    automated match to d1xbta2
    complexed with 4ta, zn

Details for d2orvb2

PDB Entry: 2orv (more details), 2.3 Å

PDB Description: human thymidine kinase 1 in complex with tp4a
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d2orvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2orvb2 g.39.1.14 (B:151-191) Thymidine kinase, TK1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
avcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk

SCOPe Domain Coordinates for d2orvb2:

Click to download the PDB-style file with coordinates for d2orvb2.
(The format of our PDB-style files is described here.)

Timeline for d2orvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2orvb1