Lineage for d2orjc2 (2orj C:205-235)

  1. Root: SCOPe 2.01
  2. 1067937Class h: Coiled coil proteins [57942] (7 folds)
  3. 1067938Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1067939Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 1067940Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 1068012Protein Surfactant protein [57949] (2 species)
  7. 1068013Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (15 PDB entries)
  8. 1068028Domain d2orjc2: 2orj C:205-235 [139266]
    Other proteins in same PDB: d2orja1, d2orjb1, d2orjc1
    automatically matched to d1m7la_
    complexed with bm3, ca

Details for d2orjc2

PDB Entry: 2orj (more details), 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with n-acetyl mannosamine
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2orjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2orjc2 h.1.1.1 (C:205-235) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelfp

SCOPe Domain Coordinates for d2orjc2:

Click to download the PDB-style file with coordinates for d2orjc2.
(The format of our PDB-style files is described here.)

Timeline for d2orjc2: