SCOPe 2.08: Domain d2oqva2: 2oqv A:509-764

Lineage for d2oqva2 (2oqv A:509-764)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries)

8. Domain d2oqva2: 2oqv A:509-764 [139251]
   Other proteins in same PDB: d2oqva1, d2oqvb1
   automated match to d1tk3a2
   complexed with ma9

Details for d2oqva2

PDB Entry: 2oqv, 2.8 Å

PDB Description: human dipeptidyl peptidase iv (dpp4) with piperidine-constrained phenethylamine

PDB Compounds: (A:) Dipeptidyl peptidase 4 (Dipeptidyl peptidase IV) (DPP IV)

SCOPe Domain Sequences for d2oqva2:

Sequence; same for both SEQRES and ATOM records:

>d2oqva2 c.69.1.0 (A:509-764) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

Timeline for d2oqva2:

• d2oqva2 first appeared in SCOP 1.73
  
• d2oqva2 appears in SCOPe 2.07