SCOPe 2.08: Domain d2oqvb1: 2oqv B:39-508

Lineage for d2oqvb1 (2oqv B:39-508)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (98 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d2oqvb1: 2oqv B:39-508 [139252]
   Other proteins in same PDB: d2oqva2, d2oqvb2
   automated match to d2bgra1
   complexed with ma9

Details for d2oqvb1

PDB Entry: 2oqv, 2.8 Å

PDB Description: human dipeptidyl peptidase iv (dpp4) with piperidine-constrained phenethylamine

PDB Compounds: (B:) Dipeptidyl peptidase 4 (Dipeptidyl peptidase IV) (DPP IV)

SCOPe Domain Sequences for d2oqvb1:

Sequence; same for both SEQRES and ATOM records:

>d2oqvb1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d2oqvb1:

• d2oqvb1 first appeared in SCOP 1.73
  
• d2oqvb1 appears in SCOPe 2.07