![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
![]() | Protein BIR domains of XIAP [57928] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57929] (14 PDB entries) Uniprot P98170 241-356 |
![]() | Domain d2opzd1: 2opz D:249-356 [139219] automatically matched to d1f9xa_ complexed with zn |
PDB Entry: 2opz (more details), 3 Å
SCOPe Domain Sequences for d2opzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2opzd1 g.52.1.1 (D:249-356) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt
Timeline for d2opzd1: