SCOPe 2.01: Domain d2oota2: 2oot A:118-350

Lineage for d2oota2 (2oot A:118-350)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.4: PA domain [52025] (1 family)

5. Family c.8.4.1: PA domain [52026] (2 proteins)

6. Protein Glutamate carboxypeptidase II [141984] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141985] (14 PDB entries)
   Uniprot Q04609 118-350

8. Domain d2oota2: 2oot A:118-350 [139177]
   Other proteins in same PDB: d2oota1, d2oota3
   automatically matched to 2C6C A:118-350
   complexed with ca, cl, nag, zn

Details for d2oota2

PDB Entry: 2oot, 1.64 Å

PDB Description: a high resolution structure of ligand-free human glutamate carboxypeptidase ii

PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d2oota2:

Sequence; same for both SEQRES and ATOM records:

>d2oota2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn

Timeline for d2oota2:

• d2oota2 first appeared in SCOP 1.73
  
• d2oota2 appears in SCOP 1.75
  
• d2oota2 appears in SCOPe 2.02
  
• d2oota2 appears in the current release, SCOPe 2.08