SCOPe 2.05: Domain d2omvb_: 2omv B:

Lineage for d2omvb_ (2omv B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (3 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Human (Homo sapiens) [TaxId:9606] [81981] (10 PDB entries)

8. Domain d2omvb_: 2omv B: [139148]
   Other proteins in same PDB: d2omva1, d2omva2
   automated match to d1o6sb_
   complexed with ca, cl

Details for d2omvb_

PDB Entry: 2omv, 1.9 Å

PDB Description: crystal structure of inla s192n y369s/hec1 complex

PDB Compounds: (B:) epithelial-cadherin

SCOPe Domain Sequences for d2omvb_:

Sequence; same for both SEQRES and ATOM records:

>d2omvb_ b.1.6.1 (B:) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
plgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieret
gwlkvtepldreriatytlfshavssngnavedpmeilitvtd

Timeline for d2omvb_:

• d2omvb_ first appeared in SCOP 1.73, called d2omvb1
  
• d2omvb_ appears in SCOPe 2.04
  
• d2omvb_ is called d2omvb2 in SCOPe 2.06
  
• d2omvb_ appears in the current release, SCOPe 2.08, called d2omvb2