Lineage for d2omvb1 (2omv B:-2-100)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657971Superfamily b.1.6: Cadherin-like [49313] (2 families) (S)
  5. 657972Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 657980Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 657981Species Human (Homo sapiens) [TaxId:9606] [81981] (3 PDB entries)
  8. 657984Domain d2omvb1: 2omv B:-2-100 [139148]
    Other proteins in same PDB: d2omva1, d2omva2
    automatically matched to d1o6sb_
    complexed with ca, cl; mutant

Details for d2omvb1

PDB Entry: 2omv (more details), 1.9 Å

PDB Description: crystal structure of inla s192n y369s/hec1 complex
PDB Compounds: (B:) epithelial-cadherin

SCOP Domain Sequences for d2omvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omvb1 b.1.6.1 (B:-2-100) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
plgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieret
gwlkvtepldreriatytlfshavssngnavedpmeilitvtd

SCOP Domain Coordinates for d2omvb1:

Click to download the PDB-style file with coordinates for d2omvb1.
(The format of our PDB-style files is described here.)

Timeline for d2omvb1: