Lineage for d2oiea1 (2oie A:21-122)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780087Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 780088Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 780101Family a.204.1.2: MazG-like [116993] (3 proteins)
    Pfam PF03819
  6. 780111Protein XTP3-transactivated gene A protein homolog RS21-C6 [140792] (1 species)
    confirmed prediction of the m5dCTPase activity
  7. 780112Species Mouse (Mus musculus) [TaxId:10090] [140793] (4 PDB entries)
    Uniprot Q9QY93 22-134
  8. 780113Domain d2oiea1: 2oie A:21-122 [139092]

Details for d2oiea1

PDB Entry: 2oie (more details), 2.2 Å

PDB Description: crystal structure of rs21-c6 core segment rscut
PDB Compounds: (A:) rs21-c6

SCOP Domain Sequences for d2oiea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oiea1 a.204.1.2 (A:21-122) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]}
rpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepg
pqawppkeraalqeelsdvliylvalaarchvdlpqaviskm

SCOP Domain Coordinates for d2oiea1:

Click to download the PDB-style file with coordinates for d2oiea1.
(The format of our PDB-style files is described here.)

Timeline for d2oiea1: